PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MA_5767g0010
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Picea
Family ZF-HD
Protein Properties Length: 225aa    MW: 24808.7 Da    PI: 9.1532
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MA_5767g0010genomeConGenIEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer101.27.2e-3290145359
   ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                    vrY+eC+kNhAa++G+ha+DGCgEfm+s g egta+alkC ACgCHRnFHR+eve 
  MA_5767g0010  90 IVRYRECQKNHAANIGSHALDGCGEFMAS-GLEGTADALKCQACGCHRNFHRQEVEG 145
                   689*************************9.999********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD1257745.0E-1991141IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047704.8E-2991143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
TIGRFAMsTIGR015661.8E-2892143IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152325.74993142IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
SuperFamilySSF466891.05E-18150223IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.6E-31152224IPR009057Homeodomain-like
TIGRFAMsTIGR015653.3E-25162219IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 225 aa     Download sequence    Send to blast
MKGNCIVHDT SRDFVRGKDP GFDLARLLSR HIQAAAEPDL SQPHHIVHET GTGNNIHGNN  60
NNAHVGQNGN GDEVKPLVEK SKKADSVEKI VRYRECQKNH AANIGSHALD GCGEFMASGL  120
EGTADALKCQ ACGCHRNFHR QEVEGEGGSG GRGVGSSSSA MKKRFRTKFS QEQKEKMHTF  180
ADQLGWRIQK HDEAAVHQFC NEAGVRRHVL KVWMHNNKNT LGKKS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A4e-271632201875ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF6769040.0EF676904.1 Picea sitchensis clone WS02757_J24 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_001777987.11e-60predicted protein
SwissprotQ9SB614e-59ZHD2_ARATH; Zinc-finger homeodomain protein 2
TrEMBLA9THC71e-60A9THC7_PHYPA; Predicted protein
STRINGEFJ045875e-58(Selaginella moellendorffii)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP9116237
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.13e-54homeobox protein 22